PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10027981m
Common NameCARUB_v10027981mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family WRKY
Protein Properties Length: 563aa    MW: 62289.3 Da    PI: 7.1879
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10027981mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY99.81.7e-31199256260
                      --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
             WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                      dDgynWrKYGqK+vkgsefprsYY+Ct+++C+vkk  ers+ d+ ++ei+Y+g+H+h+k
  Carubv10027981m 199 DDGYNWRKYGQKHVKGSEFPRSYYKCTHPNCEVKKLFERSH-DGLITEIIYKGTHDHPK 256
                      8****************************************.***************85 PP

2WRKY106.31.6e-33370428159
                      ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
             WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                      ldDgy+WrKYGqK+v+g+++prsYY+Ct +gCpv+k+ver+++dpk+v++tYeg+Hnh+
  Carubv10027981m 370 LDDGYRWRKYGQKVVRGNPNPRSYYKCTATGCPVRKHVERASHDPKAVITTYEGKHNHD 428
                      59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.809.0E-27192257IPR003657WRKY domain
PROSITE profilePS5081123.204193257IPR003657WRKY domain
SuperFamilySSF1182905.49E-25195257IPR003657WRKY domain
SMARTSM007742.6E-34198256IPR003657WRKY domain
PfamPF031063.4E-24199255IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.8E-37355430IPR003657WRKY domain
SuperFamilySSF1182902.35E-29362430IPR003657WRKY domain
PROSITE profilePS5081138.664365430IPR003657WRKY domain
SMARTSM007748.6E-39370429IPR003657WRKY domain
PfamPF031065.2E-26371428IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 563 aa     Download sequence    Send to blast
MDPDVSNRKD FPVDPDTRRN SADCGGSGAR YKLMSPAKLP ISRSAYITVP PGLSPTSFLE  60
SPVLLSNIKA EPSPTTGSLF KPQALHANTG RTIQQNISEE QKSSEFEFRP HASNMFSAEV  120
DKHRSGSPLL QFQSQGHSSK YSPSSLTEAA ASSTEISRQT VPHQTTTSVS DIPERSDPDE  180
SVQTSQNDLK ATAPSILADD GYNWRKYGQK HVKGSEFPRS YYKCTHPNCE VKKLFERSHD  240
GLITEIIYKG THDHPKPQPS RRNSGGLVMP AQEERLDKHS SLNSRDEKGS SFYNLSPPAE  300
QNGNPDVSAV SANDEGKDVA MLNRNNDDMD DNDPFSKRRR LDGAMEITPL VKPIREPRVV  360
VQTLSEVDIL DDGYRWRKYG QKVVRGNPNP RSYYKCTATG CPVRKHVERA SHDPKAVITT  420
YEGKHNHDVP TARSNSNNNN NNHDMSVPRF RPEETTDTIS LDLGVGIASG DPDHTSNEHP  480
HPHQQQQQHI RSEFIHQTQT NGTAGFRFVH GPPMGSYYGN SLNAGINHQY NGSRETAPEA  540
QTGDISSSYP YSHNIGRIQS GP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A7e-37189430877Probable WRKY transcription factor 4
2lex_A7e-37189430877Probable WRKY transcription factor 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1336340KRRRL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006281806.10.0hypothetical protein CARUB_v10027981mg
SwissprotQ93WV00.0WRK20_ARATH; Probable WRKY transcription factor 20
TrEMBLR0GDB80.0R0GDB8_9BRAS; Uncharacterized protein
STRINGscaffold_701634.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31332867
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26640.20.0WRKY family protein